HHsearch alignment for GI: 254780766 and conserved domain: COG0497

>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair].
Probab=99.88  E-value=4.2e-20  Score=150.41  Aligned_cols=154  Identities=20%  Similarity=0.212  Sum_probs=114.4

Q ss_pred             EEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCEEEEEEEECCC----
Q ss_conf             9999992232545536732798799986899864448999999728866667873688748983205898886285----
Q gi|254780766|r    7 IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGM----   82 (375)
Q Consensus         7 i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gksfR~~~~~~li~~~~~~~~~~~~~~~~~----   82 (375)
T Consensus         2 L~~LsIknfaiIe~L~leF~~GltVlTGETGAGKSIiidAl~lllG~r-----a~~~~VR~G~~~a~v~-a~F~~~~~~~   75 (557)
T COG0497           2 LLELSIKNFAIIEELELEFEKGLTVLTGETGAGKSIIIDALGLLLGGR-----ADASLVRHGAKRAEVE-AIFDLDNPPA   75 (557)
T ss_pred             CCEEEEEHEEEEEEEEEECCCCCEEEECCCCCCHHHHHHHHHHHHCCC-----CCCCHHCCCCCEEEEE-EEECCCCHHH
T ss_conf             737745010010212241068956865688875667998999972787-----7811211788606899-9854796688


Q ss_pred             ---------CCCEEEEEEEECCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCEEECCHHHCCCCCCHHHHHHCCCCCCCC
Q ss_conf             ---------320026675300246633321125774333--210123334520210011001268723412101000135
Q gi|254780766|r   83 ---------EGLADISIKLETRDDRSVRCLQINDVVIRV--VDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAI  151 (375)
Q Consensus        83 ---------~~~~~~~~~~~~~~~~~~k~~~~n~~~~~~--~~~l~~~l~~v~~~p~~~~li~~~p~~RR~flD~~i~~~  151 (375)
T Consensus        76 ~~~L~e~gie~~~~iilrR~i~~~GrS-r~~INg~~Vs~~~L~~l~~~L--i~IHGQh~~q~Ll~~~~~r~lLD~f~~~~  152 (557)
T COG0497          76 RAWLEENGIEDDEEVILRRVISADGRS-RAFINGQPVSLAQLKELGQLL--IDIHGQHEHQSLLKPELQRQLLDAFAGLE  152 (557)
T ss_pred             HHHHHHCCCCCCCCEEEEEEECCCCCE-EEEECCEEEEHHHHHHHHHHH--EEEECCCHHHHHCCHHHHHHHHHHHCCCH
T ss_conf             999997599976757999887277861-688999983099999999766--01226631777619488999998745755


Q ss_pred             CH---HHHHHHHHHHHHHHHH
Q ss_conf             84---6778887777666667
Q gi|254780766|r  152 DP---RHRRRMIDFERLMRGR  169 (375)
Q Consensus       152 ~~---~y~~~l~~y~K~LkqR  169 (375)
T Consensus       153 ~~~~~~~~~~y~~w~~~~~~l  173 (557)
T COG0497         153 ELAQEAYQEAYQAWKQARREL  173 (557)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
T ss_conf             789999999999999999999