HHsearch alignment for GI: 254780766 and conserved domain: COG1118

>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism].
Probab=98.04  E-value=4e-05  Score=52.64  Aligned_cols=79  Identities=24%  Similarity=0.233  Sum_probs=60.1

Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHH----HCCCCEEEEECCHHHHHHHHC
Q ss_conf             3122058999999999999999998708997899801220159899999999974----179809998069678543212
Q gi|254780766|r  285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT----DIGSQIFMTGTDKSVFDSLNE  360 (375)
Q Consensus       285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~----~~~~Qv~iTt~~~~~~~~~~~  360 (375)
T Consensus       136 ~qLSGGQrQRVALARALA---------~eP~vLLLDEPf~ALDa~vr~~lr~wLr~~~~~~~~ttvfVTHD~eea~~lad  206 (345)
T COG1118         136 AQLSGGQRQRVALARALA---------VEPKVLLLDEPFGALDAKVRKELRRWLRKLHDRLGVTTVFVTHDQEEALELAD  206 (345)
T ss_pred             HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHCC
T ss_conf             212717889999998753---------49986863587214519999999999999998609639999589999986416


Q ss_pred             CEEEEEECCCEEEE
Q ss_conf             60079972896895
Q gi|254780766|r  361 TAKFMRISNHQALC  374 (375)
Q Consensus       361 ~~~~~~i~~g~~~~  374 (375)
T Consensus       207 r--vvvl~~G~Ieq  218 (345)
T COG1118         207 R--VVVLNQGRIEQ  218 (345)
T ss_pred             E--EEEECCCEEEE
T ss_conf             5--99952880553