HHsearch alignment for GI: 254780766 and conserved domain: COG1121

>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism].
Probab=97.58  E-value=0.00016  Score=48.76  Aligned_cols=46  Identities=28%  Similarity=0.510  Sum_probs=31.2

Q ss_pred             CCCEEEEEEEEECCC---CHHHEEEECCC-CEEEEECCCCCCHHHHHHHHH
Q ss_conf             885189999992232---54553673279-879998689986444899999
Q gi|254780766|r    2 TNRIKIKFLNISEFR---NYASLRLVFDA-QHTIFVGDNGVGKTNILEAIS   48 (375)
Q Consensus         2 ~~~M~i~~l~i~nFR---~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~   48 (375)
T Consensus         2 ~~~i~v~nl~v~-y~~~~vl~~i~l~v~~G~~~~iiGPNGaGKSTLlK~iL   51 (254)
T COG1121           2 MPMIEVENLTVS-YGNRPVLEDISLSVEKGEITALIGPNGAGKSTLLKAIL   51 (254)
T ss_pred             CCEEEEEEEEEE-ECCEEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             867999414999-89975041538997489689999998888899999996