HHsearch alignment for GI: 254780766 and conserved domain: COG1132

>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].
Probab=97.69  E-value=0.00064  Score=44.80  Aligned_cols=78  Identities=18%  Similarity=0.317  Sum_probs=57.3

Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCE
Q ss_conf             312205899999999999999999870899789980122015989999999997417--980999806967854321260
Q gi|254780766|r  285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETA  362 (375)
Q Consensus       285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~  362 (375)
T Consensus       464 ~~LSgGQrQriaiARal---------l~~~~iLILDEaTS~lD~~tE~~I~~~l~~l~~~rT~iiIaHRlsti~~---aD  531 (567)
T COG1132         464 VNLSGGQRQRLAIARAL---------LRNPPILILDEATSALDTETEALIQDALKKLLKGRTTLIIAHRLSTIKN---AD  531 (567)
T ss_pred             CCCCHHHHHHHHHHHHH---------HHCCCEEEECCHHHCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHH---CC
T ss_conf             71889999999999997---------0369868872311026775699999999998269879998667225874---88


Q ss_pred             EEEEECCCEEEE
Q ss_conf             079972896895
Q gi|254780766|r  363 KFMRISNHQALC  374 (375)
Q Consensus       363 ~~~~i~~g~~~~  374 (375)
T Consensus       532 ~IiVl~~G~i~e  543 (567)
T COG1132         532 RIIVLDNGRIVE  543 (567)
T ss_pred             EEEEEECCEEEE
T ss_conf             899975875788