HHsearch alignment for GI: 254780766 and conserved domain: COG1196

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning].
Probab=99.12  E-value=1.6e-08  Score=74.89  Aligned_cols=93  Identities=17%  Similarity=0.285  Sum_probs=72.4

Q ss_pred             EECCCCCCCHH-HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEE
Q ss_conf             10012455102-3312205899999999999999999870899789980122015989999999997417--98099980
Q gi|254780766|r  273 LIVDYCDKAIT-IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTG  349 (375)
Q Consensus       273 ~~~~~~~~~~~-~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt  349 (375)
T Consensus      1052 i~a~ppgK~~~~l~~LSGGEKsLtAlAllFAi-----~~~~PaPf~vLDEVDAaLD~~Nv~r~~~~i~e~s~~sQFIvIT 1126 (1163)
T COG1196        1052 ISARPPGKKLQSLSLLSGGEKSLTALALLFAI-----QKYRPAPFYVLDEVDAALDDANVERVARLIKEMSKETQFIVIT 1126 (1163)
T ss_pred             EEEECCCCCCCCCCCCCCCHHHHHHHHHHHHH-----HHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             99738998656212148618999999999999-----7137998688624543566899999999999817898289997


Q ss_pred             CCHHHHHHHHCCEEEEEECCC
Q ss_conf             696785432126007997289
Q gi|254780766|r  350 TDKSVFDSLNETAKFMRISNH  370 (375)
Q Consensus       350 ~~~~~~~~~~~~~~~~~i~~g  370 (375)
T Consensus      1127 hr~~~m~~ad~l~GVtm~~~G 1147 (1163)
T COG1196        1127 HRKGTMEAADRLVGVTMQEKG 1147 (1163)
T ss_pred             CCHHHHHHHHHEEEEEEECCC
T ss_conf             774888877770148996499