HHsearch alignment for GI: 254780766 and conserved domain: COG3910

>COG3910 Predicted ATPase [General function prediction only].
Probab=99.11  E-value=2e-09  Score=80.66  Aligned_cols=65  Identities=25%  Similarity=0.338  Sum_probs=49.5

Q ss_pred             HHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH---CCCCEEEEECCHHHHHHHHCCEEEEEECCCEE
Q ss_conf             99987089978998012201598999999999741---79809998069678543212600799728968
Q gi|254780766|r  306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD---IGSQIFMTGTDKSVFDSLNETAKFMRISNHQA  372 (375)
Q Consensus       306 ~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~---~~~Qv~iTt~~~~~~~~~~~~~~~~~i~~g~~  372 (375)
T Consensus       139 i~~~rf~~~GiYiLDEPEa~LSp~RQlella~l~~la~sGaQ~IiATHSPiLlA-iP-~A~I~~~~~~g~  206 (233)
T COG3910         139 IFHNRFNGQGIYILDEPEAALSPSRQLELLAILRDLADSGAQIIIATHSPILLA-IP-GAEIYEISESGI  206 (233)
T ss_pred             HHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHEE-CC-CCEEEEEECCCC
T ss_conf             999983158418856864447888899999999998736783999836814200-78-847999806875