HHsearch alignment for GI: 254780766 and conserved domain: COG4133

>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones].
Probab=97.52  E-value=0.00022  Score=47.80  Aligned_cols=65  Identities=22%  Similarity=0.302  Sum_probs=50.5

Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH---CCCCEEEEECCHHHHH
Q ss_conf             2331220589999999999999999987089978998012201598999999999741---7980999806967854
Q gi|254780766|r  283 TIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD---IGSQIFMTGTDKSVFD  356 (375)
Q Consensus       283 ~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~---~~~Qv~iTt~~~~~~~  356 (375)
T Consensus       127 p~~~LSAGQqRRvAlArL~l---------s~~pLWiLDEP~taLDk~g~a~l~~l~~~H~~~GGiVllttHq~l~~~  194 (209)
T COG4133         127 PVGQLSAGQQRRVALARLWL---------SPAPLWILDEPFTALDKEGVALLTALMAAHAAQGGIVLLTTHQPLPIA  194 (209)
T ss_pred             CHHHCCHHHHHHHHHHHHHC---------CCCCCEEECCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCC
T ss_conf             02223646899999999972---------788716644853224987899999999998527988999647756777