HHsearch alignment for GI: 254780766 and conserved domain: COG4161

>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism].
Probab=97.37  E-value=0.0011  Score=43.22  Aligned_cols=76  Identities=25%  Similarity=0.382  Sum_probs=55.6

Q ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---C-CCEEEEECCHHHHHHHHCC
Q ss_conf             12205899999999999999999870899789980122015989999999997417---9-8099980696785432126
Q gi|254780766|r  286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---G-SQIFMTGTDKSVFDSLNET  361 (375)
Q Consensus       286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~-~Qv~iTt~~~~~~~~~~~~  361 (375)
T Consensus       141 hlsggqqqrvaiaral---------mmkpqvllfdeptaaldpeitaqvv~iikel~~tgitqvivt-hev~va~k~--a  208 (242)
T COG4161         141 HLSGGQQQRVAIARAL---------MMEPQVLLFDEPTAALDPEITAQIVSIIKELAETGITQVIVT-HEVEVARKT--A  208 (242)
T ss_pred             ECCCCHHHHHHHHHHH---------HCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEE-EEHHHHHHH--H
T ss_conf             1266313459999998---------458867963586221587889999999999875685189998-431477764--3


Q ss_pred             EEEEEECCCEEE
Q ss_conf             007997289689
Q gi|254780766|r  362 AKFMRISNHQAL  373 (375)
Q Consensus       362 ~~~~~i~~g~~~  373 (375)
T Consensus       209 s~vvyme~g~iv  220 (242)
T COG4161         209 SRVVYMENGHIV  220 (242)
T ss_pred             HHEEEEECCEEE
T ss_conf             416753267467