HHsearch alignment for GI: 254780766 and conserved domain: COG4694

>COG4694 Uncharacterized protein conserved in bacteria [Function unknown].
Probab=97.80  E-value=0.00046  Score=45.74  Aligned_cols=67  Identities=16%  Similarity=0.203  Sum_probs=53.1

Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHH-HCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHH
Q ss_conf             3122058999999999999999998-70899789980122015989999999997417---980999806967
Q gi|254780766|r  285 AHGSTGEQKVVLVGIFLAHARLISN-TTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKS  353 (375)
Q Consensus       285 ~~~S~Gqqk~~~l~l~La~~~~~~~-~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~  353 (375)
T Consensus       528 n~LSEGekt~iaf~yflakLk--enpd~~k~kvvViDDPisSfDsn~lf~~~~~v~~~~t~~kQviVLtHntY  598 (758)
T COG4694         528 NTLSEGEKTFIAFLYFLAKLK--ENPDISKNKVVVIDDPISSFDSNILFRVSVLVKEEKTNIKQVIVLTHNTY  598 (758)
T ss_pred             CCCCCCHHHHHHHHHHHHHHH--HCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCEEEEEEECCCE
T ss_conf             313565045789999999987--47654348069966874323124899999999999736517999953632