HHsearch alignment for GI: 254780766 and conserved domain: COG4717

>COG4717 Uncharacterized conserved protein [Function unknown].
Probab=98.40  E-value=6.9e-06  Score=57.63  Aligned_cols=49  Identities=20%  Similarity=0.446  Sum_probs=44.8

Q ss_pred             EEEEEEEEECCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHHHCCC
Q ss_conf             189999992232545536732798-7999868998644489999997288
Q gi|254780766|r    5 IKIKFLNISEFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISFLSPG   53 (375)
Q Consensus         5 M~i~~l~i~nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~l~~g   53 (375)
T Consensus         1 MrI~sl~I~gYGKFs~r~~df~~s~f~vI~G~NEAGKSTl~sFI~smlFG   50 (984)
T COG4717           1 MRIQSLEIVGYGKFSERHFDFGESKFQVIYGENEAGKSTLFSFIHSMLFG   50 (984)
T ss_pred             CCEEEEEEEECCCHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHCC
T ss_conf             91268886401406665540467844798457631177799999999817