HHsearch alignment for GI: 254780766 and conserved domain: COG4987

>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones].
Probab=97.64  E-value=0.00041  Score=46.04  Aligned_cols=76  Identities=20%  Similarity=0.297  Sum_probs=57.1

Q ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEE
Q ss_conf             12205899999999999999999870899789980122015989999999997417--9809998069678543212600
Q gi|254780766|r  286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAK  363 (375)
Q Consensus       286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~  363 (375)
T Consensus       474 ~LSGGE~rRLAlAR~LL---------~dapl~lLDEPTegLD~~TE~~vL~ll~~~~~~kTll~vTHrL~~le~---~dr  541 (573)
T COG4987         474 RLSGGERRRLALARALL---------HDAPLWLLDEPTEGLDPITERQVLALLFEHAEGKTLLMVTHRLRGLER---MDR  541 (573)
T ss_pred             CCCCHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHH---CCE
T ss_conf             47813899999999997---------079868844886667864399999999998459859999645421765---687


Q ss_pred             EEEECCCEEE
Q ss_conf             7997289689
Q gi|254780766|r  364 FMRISNHQAL  373 (375)
Q Consensus       364 ~~~i~~g~~~  373 (375)
T Consensus       542 Iivl~~Gkii  551 (573)
T COG4987         542 IIVLDNGKII  551 (573)
T ss_pred             EEEEECCEEE
T ss_conf             7998777556