HHsearch alignment for GI: 254780766 and conserved domain: COG4988

>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones].
Probab=96.31  E-value=0.0041  Score=39.50  Aligned_cols=33  Identities=33%  Similarity=0.540  Sum_probs=26.3

Q ss_pred             CCHHHEEEECCC-CEEEEECCCCCCHHHHHHHHH
Q ss_conf             254553673279-879998689986444899999
Q gi|254780766|r   16 RNYASLRLVFDA-QHTIFVGDNGVGKTNILEAIS   48 (375)
Q Consensus        16 R~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~   48 (375)
T Consensus       335 ~~l~~l~~t~~~g~~talvG~SGaGKSTLl~lL~  368 (559)
T COG4988         335 PALSDLNLTIKAGQLTALVGASGAGKSTLLNLLL  368 (559)
T ss_pred             CCCCCCEEEECCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             5566710675489679998899997899999984