HHsearch alignment for GI: 254780766 and conserved domain: KOG0054

>KOG0054 consensus.
Probab=96.57  E-value=0.028  Score=34.04  Aligned_cols=31  Identities=29%  Similarity=0.467  Sum_probs=22.5

Q ss_pred             CHHHEEEECCC-CEEEEECCCCCCHHHHHHHH
Q ss_conf             54553673279-87999868998644489999
Q gi|254780766|r   17 NYASLRLVFDA-QHTIFVGDNGVGKTNILEAI   47 (375)
Q Consensus        17 ~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI   47 (375)
T Consensus       536 tL~dIn~~i~~G~lvaVvG~vGsGKSSLL~Ai  567 (1381)
T KOG0054         536 TLKDINFEIKKGQLVAVVGPVGSGKSSLLSAI  567 (1381)
T ss_pred             CCCCEEEEECCCCEEEEECCCCCCHHHHHHHH
T ss_conf             30141589628988999899988889999999