HHsearch alignment for GI: 254780766 and conserved domain: KOG0250

>KOG0250 consensus.
Probab=99.69  E-value=1.1e-15  Score=121.47  Aligned_cols=135  Identities=24%  Similarity=0.336  Sum_probs=94.9

Q ss_pred             EEEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCC---CCCCCHHHHHHCCCCCEEEEE-EEECC
Q ss_conf             89999992232545536732798799986899864448999999728866---667873688748983205898-88628
Q gi|254780766|r    6 KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRG---FRRASYADVTRIGSPSFFSTF-ARVEG   81 (375)
Q Consensus         6 ~i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gks---fR~~~~~~li~~~~~~~~~~~-~~~~~   81 (375)
T Consensus        41 ~I~sI~L~NFMCHsnL~IeFg~~vNfI~G~NGSGKSAIltAl~lglG~rAs~tnRgsslK~lIK~G~~~A~IsItL~N~G  120 (1074)
T KOG0250          41 KIESIHLTNFMCHSNLLIEFGPRVNFIVGNNGSGKSAILTALTLGLGGRASATNRGSSLKDLIKDGCSSAKISITLSNSG  120 (1074)
T ss_pred             EEEEEEEEEECCCCCCEECCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHCCCCCEEEEEEEECCC
T ss_conf             38999975210333541025887137646898748999999998626531456530439999967875148999982577


Q ss_pred             CC------CCEEEEEEEECCCCCCCCCCC--CCCCCCCC-CCCC---CCCC------CCCEEECCHHH--CCCCCCHHH
Q ss_conf             53------200266753002466333211--25774333-2101---2333------45202100110--012687234
Q gi|254780766|r   82 ME------GLADISIKLETRDDRSVRCLQ--INDVVIRV-VDEL---NKHL------RISWLVPSMDR--IFSGLSMER  140 (375)
Q Consensus        82 ~~------~~~~~~~~~~~~~~~~~k~~~--~n~~~~~~-~~~l---~~~l------~~v~~~p~~~~--li~~~p~~R  140 (375)
T Consensus       121 ~~Afk~eiyG~~IiIER~I~~~~S~~~~~~~~~grvVStKk~dl~~vv~~f~I~veNP~~~lsQD~aR~FL~~~~p~dk  199 (1074)
T KOG0250         121 LDAFKPEIYGNSIIIERTIRRSSSTYYLLRSANGRVVSTKKEDLDTVVDHFNIQVENPMFVLSQDAARSFLANSNPKDK  199 (1074)
T ss_pred             CCCCCHHHCCCEEEEEEEECCCCCHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCHHHCHHHHHHHHHCCCHHHH
T ss_conf             6667745438805999862356525888760367622361988999999828677784023048889999854993778