HHsearch alignment for GI: 254780766 and conserved domain: KOG0927

>KOG0927 consensus.
Probab=98.90  E-value=1.8e-07  Score=67.93  Aligned_cols=85  Identities=20%  Similarity=0.298  Sum_probs=68.5

Q ss_pred             CCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHH
Q ss_conf             45510233122058999999999999999998708997899801220159899999999974179809998069678543
Q gi|254780766|r  278 CDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDS  357 (375)
Q Consensus       278 ~~~~~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Qv~iTt~~~~~~~~  357 (375)
T Consensus       501 d~q~~p~~~LS~Gqr~rVlFa~l~~---------kqP~lLlLDEPtnhLDi~tid~laeaiNe~~Ggvv~vSHDfrlI~q  571 (614)
T KOG0927         501 DAQVVPMSQLSDGQRRRVLFARLAV---------KQPHLLLLDEPTNHLDIETIDALAEAINEFPGGVVLVSHDFRLISQ  571 (614)
T ss_pred             CCCCCCHHHCCCCCCHHHHHHHHHH---------CCCCEEEECCCCCCCCCHHHHHHHHHHHCCCCCEEEEECHHHHHHH
T ss_conf             2101336442610001478999884---------3884798548876788506999999985267851553212348998


Q ss_pred             HHCCEEEEEECCCEEE
Q ss_conf             2126007997289689
Q gi|254780766|r  358 LNETAKFMRISNHQAL  373 (375)
Q Consensus       358 ~~~~~~~~~i~~g~~~  373 (375)
T Consensus       572 VaeE--i~~c~~~~~~  585 (614)
T KOG0927         572 VAEE--IWVCENGTVT  585 (614)
T ss_pred             HHHH--HHHHCCCCEE
T ss_conf             8777--6701058366