HHsearch alignment for GI: 254780766 and conserved domain: KOG0933

>KOG0933 consensus.
Probab=97.94  E-value=0.00065  Score=44.75  Aligned_cols=72  Identities=25%  Similarity=0.440  Sum_probs=60.3

Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHH
Q ss_conf             23312205899999999999999999870899789980122015989999999997417--980999806967854321
Q gi|254780766|r  283 TIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLN  359 (375)
Q Consensus       283 ~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~  359 (375)
T Consensus      1079 SL~ELSGGQRSLVALsLIlamL~f-----kPAPlYILDEVDAALDLSHTQNIG~mIkthF~~sQFIVVSLKeGMF~NAN 1152 (1174)
T KOG0933        1079 SLSELSGGQRSLVALSLILAMLKF-----KPAPLYILDEVDAALDLSHTQNIGRMIKTHFTHSQFIVVSLKEGMFNNAN 1152 (1174)
T ss_pred             HHHHHCCCHHHHHHHHHHHHHHCC-----CCCCEEEHHHHHHHHCCHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCH
T ss_conf             787705740779999999999817-----99751102346776333522127899983278872899973000000431