HHsearch alignment for GI: 254780766 and conserved domain: KOG0979

>KOG0979 consensus.
Probab=99.63  E-value=1.2e-14  Score=114.85  Aligned_cols=120  Identities=20%  Similarity=0.315  Sum_probs=89.9

Q ss_pred             EEEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCC---CCCCCHHHHHHCCCCCEEEEEEEECCC
Q ss_conf             89999992232545536732798799986899864448999999728866---667873688748983205898886285
Q gi|254780766|r    6 KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRG---FRRASYADVTRIGSPSFFSTFARVEGM   82 (375)
Q Consensus         6 ~i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gks---fR~~~~~~li~~~~~~~~~~~~~~~~~   82 (375)
T Consensus        21 sIvrI~l~NF~Ty~~~e~~pgpsLNmIiGpNGSGKSSiVcAIcLglgG~Pk~lGRak~VgeyIK~G~~~g~IEI~-l~~~   99 (1072)
T KOG0979          21 SIVRIELHNFLTYDHTEFLPGPSLNMIIGPNGSGKSSIVCAICLGLGGKPKLLGRAKKVGEYIKRGEDEGYIEIE-LKDK   99 (1072)
T ss_pred             CEEEEEEEEEEEEEEEEECCCCCEEEEECCCCCCCHHHHHHHHHHCCCCHHHCCCHHHHHHHHHCCCCCCEEEEE-EECC
T ss_conf             669999740044433344378861268778989704889999997279744314355799999647766369999-9627


Q ss_pred             CCCEEEEEEEECCCCCCCCCCCCCCCCCCC--CCCCCCCCCC-----CEEECCH
Q ss_conf             320026675300246633321125774333--2101233345-----2021001
Q gi|254780766|r   83 EGLADISIKLETRDDRSVRCLQINDVVIRV--VDELNKHLRI-----SWLVPSM  129 (375)
Q Consensus        83 ~~~~~~~~~~~~~~~~~~k~~~~n~~~~~~--~~~l~~~l~~-----v~~~p~~  129 (375)
T Consensus       100 ~e--~~~ItR~I~~~k~-S~y~iN~~a~t~s~i~elv~~fNIQi~NLCqFLpQD  150 (1072)
T KOG0979         100 DE--TLTITRLISRDKE-SKYFINDSATTKSEIEELVAHFNIQIDNLCQFLPQD  150 (1072)
T ss_pred             CC--CEEEEEEEEECCC-CCEEECCCHHHHHHHHHHHHHHHCCCCCHHHHCCHH
T ss_conf             88--6479998730577-535545521006899999999703127465435687