HHsearch alignment for GI: 254780766 and conserved domain: PRK09700

>PRK09700 D-allose transporter ATP-binding protein; Provisional.
Probab=98.37  E-value=3.8e-06  Score=59.35  Aligned_cols=80  Identities=16%  Similarity=0.340  Sum_probs=66.6

Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC
Q ss_conf             312205899999999999999999870899789980122015989999999997417---98099980696785432126
Q gi|254780766|r  285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET  361 (375)
Q Consensus       285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~  361 (375)
T Consensus       408 ~~LSGGq~Qrv~iAraL~---------~~p~lLilDEPT~GlD~~~~~~i~~li~~l~~~G~tvl~ishdl~ev~~~~DR  478 (510)
T PRK09700        408 TELSGGNQQKVLISKWLC---------CCPEVIIFDEPTRGIDVGAKAEIYKVMRQLADDGKVILMVSSELPEIITVCDR  478 (510)
T ss_pred             HHCCHHHHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE
T ss_conf             459999999999999998---------59988999797558999999999999999996899999990758999986999


Q ss_pred             EEEEEECCCEEEEC
Q ss_conf             00799728968959
Q gi|254780766|r  362 AKFMRISNHQALCI  375 (375)
Q Consensus       362 ~~~~~i~~g~~~~~  375 (375)
T Consensus       479 --i~Vm~~G~iv~~  490 (510)
T PRK09700        479 --IAVFCEGRLTQI  490 (510)
T ss_pred             --EEEEECCEEEEE
T ss_conf             --999989999999