HHsearch alignment for GI: 254780766 and conserved domain: PRK10522

>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional.
Probab=97.95  E-value=0.00011  Score=49.76  Aligned_cols=77  Identities=26%  Similarity=0.360  Sum_probs=56.2

Q ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH----CCCCEEEEECCHHHHHHHHCC
Q ss_conf             1220589999999999999999987089978998012201598999999999741----798099980696785432126
Q gi|254780766|r  286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD----IGSQIFMTGTDKSVFDSLNET  361 (375)
Q Consensus       286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~----~~~Qv~iTt~~~~~~~~~~~~  361 (375)
T Consensus       449 ~LSGGQrQRiaIARAll---------~~p~ILILDEaTSaLD~~te~~i~~~l~~~~~~~grT~IvIaHRLst---i~~a  516 (547)
T PRK10522        449 KLSKGQKKRLALLLALA---------EERDILLLDEWAADQDPHFRREFYQVLLPLLQEMGKTIFAISHDDHY---FIHA  516 (547)
T ss_pred             CCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHH---HHHC
T ss_conf             62999999999999997---------49999999685557899999999999999987069899998248899---9819


Q ss_pred             EEEEEECCCEEEE
Q ss_conf             0079972896895
Q gi|254780766|r  362 AKFMRISNHQALC  374 (375)
Q Consensus       362 ~~~~~i~~g~~~~  374 (375)
T Consensus       517 D~IiVl~~G~IvE  529 (547)
T PRK10522        517 DRLLEMRNGQLSE  529 (547)
T ss_pred             CEEEEEECCEEEE
T ss_conf             9899998999998