HHsearch alignment for GI: 254780766 and conserved domain: PRK10575

>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional.
Probab=97.60  E-value=8.1e-05  Score=50.64  Aligned_cols=33  Identities=33%  Similarity=0.523  Sum_probs=27.0

Q ss_pred             CCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH
Q ss_conf             2545536732798-79998689986444899999
Q gi|254780766|r   16 RNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS   48 (375)
Q Consensus        16 R~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~   48 (375)
T Consensus        25 ~vL~~vsl~i~~Ge~~~liG~NGaGKSTLl~~l~   58 (265)
T PRK10575         25 TLLHPLSLTFPAGKVTGLIGHNGSGKSTLLKMLG   58 (265)
T ss_pred             EEEECEEEEECCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             9881508898799899999999980999999995