HHsearch alignment for GI: 254780766 and conserved domain: PRK10584

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional.
Probab=98.55  E-value=4.5e-07  Score=65.40  Aligned_cols=77  Identities=22%  Similarity=0.326  Sum_probs=63.0

Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC
Q ss_conf             312205899999999999999999870899789980122015989999999997417----9809998069678543212
Q gi|254780766|r  285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE  360 (375)
Q Consensus       285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~  360 (375)
T Consensus       145 ~~LSGGq~QRv~iAraL~---------~~P~llllDEPT~~LD~~~~~~i~~~l~~l~~~~g~tii~vtHd~~~~~~-~-  213 (228)
T PRK10584        145 AQLSGGEQQRVALARAFN---------GRPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLILVTHDLQLAAR-C-  213 (228)
T ss_pred             CCCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHH-C-
T ss_conf             889979999999999987---------59999998499767899999999999999999729899998866999985-8-


Q ss_pred             CEEEEEECCCEEE
Q ss_conf             6007997289689
Q gi|254780766|r  361 TAKFMRISNHQAL  373 (375)
Q Consensus       361 ~~~~~~i~~g~~~  373 (375)
T Consensus       214 -drvi~l~~G~Iv  225 (228)
T PRK10584        214 -DRRLRLVNGQLQ  225 (228)
T ss_pred             -CCEEEEECCEEE
T ss_conf             -979999899999