HHsearch alignment for GI: 254780766 and conserved domain: PRK10744

>PRK10744 phosphate transporter subunit; Provisional.
Probab=97.26  E-value=0.0004  Score=46.15  Aligned_cols=36  Identities=28%  Similarity=0.549  Sum_probs=27.5

Q ss_pred             CCCHHHEEEECCC-CEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             3254553673279-87999868998644489999997
Q gi|254780766|r   15 FRNYASLRLVFDA-QHTIFVGDNGVGKTNILEAISFL   50 (375)
Q Consensus        15 FR~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~~l   50 (375)
T Consensus        23 ~~aL~~vsl~i~~Ge~~~liG~nGaGKSTLlk~i~gl   59 (257)
T PRK10744         23 FHALKNINLDIAKNQVTAFIGPSGCGKSTLLRTFNKM   59 (257)
T ss_pred             EEEECCCEEEECCCCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             7678142899889989999999998199999999876