HHsearch alignment for GI: 254780766 and conserved domain: PRK10982

>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional.
Probab=98.35  E-value=4.4e-06  Score=58.89  Aligned_cols=79  Identities=20%  Similarity=0.272  Sum_probs=65.0

Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC
Q ss_conf             312205899999999999999999870899789980122015989999999997417---98099980696785432126
Q gi|254780766|r  285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET  361 (375)
Q Consensus       285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~  361 (375)
T Consensus       133 ~~LSgG~~Qrv~ia~al~---------~~p~ililDEPt~~LD~~~~~~l~~~l~~l~~~g~til~itH~l~~v~~~~Dr  203 (491)
T PRK10982        133 ATLSVSQMQMIEIAKAFS---------YNAKIVIMDEPTSSLTEKEVNHLFTIIRKLKERGCGIVYISHKMEEIFQLCDE  203 (491)
T ss_pred             HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHCCCE
T ss_conf             558999999999999985---------39988981587345587888999888888774285367862436744215867


Q ss_pred             EEEEEECCCEEEE
Q ss_conf             0079972896895
Q gi|254780766|r  362 AKFMRISNHQALC  374 (375)
Q Consensus       362 ~~~~~i~~g~~~~  374 (375)
T Consensus       204 --v~vm~~G~iv~  214 (491)
T PRK10982        204 --ITILRDGQWIA  214 (491)
T ss_pred             --EEECCCCEEEE
T ss_conf             --89756974985