HHsearch alignment for GI: 254780766 and conserved domain: PRK11248

>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional.
Probab=97.48  E-value=0.00015  Score=48.96  Aligned_cols=35  Identities=23%  Similarity=0.404  Sum_probs=27.5

Q ss_pred             CCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHH
Q ss_conf             32545536732798-799986899864448999999
Q gi|254780766|r   15 FRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISF   49 (375)
Q Consensus        15 FR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~   49 (375)
T Consensus        14 ~~~L~dvsl~i~~Ge~~~lvGpnGaGKSTLl~~i~G   49 (255)
T PRK11248         14 KPALEDINLTLESGELLVVLGPSGCGKTTLLNLIAG   49 (255)
T ss_pred             EEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHC
T ss_conf             988813177986998999999998469999999975