HHsearch alignment for GI: 254780766 and conserved domain: PRK11264

>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional.
Probab=97.29  E-value=0.00036  Score=46.42  Aligned_cols=33  Identities=27%  Similarity=0.498  Sum_probs=26.5

Q ss_pred             HHHEEEECCCC-EEEEECCCCCCHHHHHHHHHHH
Q ss_conf             45536732798-7999868998644489999997
Q gi|254780766|r   18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAISFL   50 (375)
Q Consensus        18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~l   50 (375)
T Consensus        17 l~~vsl~i~~Ge~~aliG~sGsGKSTLl~~l~gl   50 (248)
T PRK11264         17 LHGIDLEVKPGEVVAIIGPSGSGKTTLLRCINLL   50 (248)
T ss_pred             EECEEEEECCCCEEEEECCCCCCHHHHHHHHHCC
T ss_conf             9431779879989999999998099999999758