HHsearch alignment for GI: 254780766 and conserved domain: PRK13538

>PRK13538 cytochrome c biogenesis protein CcmA; Provisional.
Probab=98.56  E-value=3.5e-07  Score=66.10  Aligned_cols=74  Identities=19%  Similarity=0.270  Sum_probs=57.8

Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC
Q ss_conf             312205899999999999999999870899789980122015989999999997417---98099980696785432126
Q gi|254780766|r  285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET  361 (375)
Q Consensus       285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~  361 (375)
T Consensus       128 ~~LSgGqkqRv~lAral~---------~~p~lllLDEPt~~LD~~~~~~l~~~l~~~~~~g~~vi~~tH~--dl~~~ad~  196 (204)
T PRK13538        128 RQLSAGQQRRVALARLWL---------TRAPLWILDEPFTAIDKQGVARLEQLLAQHAEQGGMVILTTHQ--DLPGASDK  196 (204)
T ss_pred             HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECH--HHHHHCCE
T ss_conf             248999999999999996---------0999899978865789999999999999998589989999866--98987699


Q ss_pred             EEEEEECCCE
Q ss_conf             0079972896
Q gi|254780766|r  362 AKFMRISNHQ  371 (375)
Q Consensus       362 ~~~~~i~~g~  371 (375)
T Consensus       197 --v~vl~~Gq  204 (204)
T PRK13538        197 --VRKLRLGQ  204 (204)
T ss_pred             --EEEECCCC
T ss_conf             --99973979