HHsearch alignment for GI: 254780766 and conserved domain: PRK13541

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional.
Probab=98.20  E-value=8.9e-06  Score=56.92  Aligned_cols=64  Identities=27%  Similarity=0.383  Sum_probs=52.4

Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH---CCCCEEEEECCHHHHHH
Q ss_conf             31220589999999999999999987089978998012201598999999999741---79809998069678543
Q gi|254780766|r  285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD---IGSQIFMTGTDKSVFDS  357 (375)
Q Consensus       285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~---~~~Qv~iTt~~~~~~~~  357 (375)
T Consensus       122 ~~LS~G~kqrv~iAral~---------~~p~llllDEPt~~LD~~~~~~i~~li~~~~~~g~~ili~sH~~~~i~~  188 (195)
T PRK13541        122 YSLSSGMQKVVALARLIA---------CQSDLWLLDEVETNLSKENRDLLNNLIVMKANSGGIVLLSSHLESSIKS  188 (195)
T ss_pred             HHCCHHHHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHH
T ss_conf             459999999999999997---------0999999978765599999999999999998399999998379899941