HHsearch alignment for GI: 254780766 and conserved domain: PRK13545

>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional.
Probab=97.39  E-value=0.0021  Score=41.40  Aligned_cols=34  Identities=21%  Similarity=0.261  Sum_probs=25.3

Q ss_pred             CCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH
Q ss_conf             32545536732798-79998689986444899999
Q gi|254780766|r   15 FRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS   48 (375)
Q Consensus        15 FR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~   48 (375)
T Consensus        37 f~ALknVSFeV~kGE~vGIIG~NGAGKSTLLKiIa   71 (549)
T PRK13545         37 HYALNNISFEVPEGEIVGIVGLNGSGKSTLSNLIA   71 (549)
T ss_pred             EEEECCCEEEECCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             77340725786489899998899998999999996