HHsearch alignment for GI: 254780766 and conserved domain: PRK13545

>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional.
Probab=96.34  E-value=0.0035  Score=39.95  Aligned_cols=80  Identities=18%  Similarity=0.151  Sum_probs=62.0

Q ss_pred             HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHC
Q ss_conf             3312205899999999999999999870899789980122015989999999997417---9809998069678543212
Q gi|254780766|r  284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNE  360 (375)
Q Consensus       284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~  360 (375)
T Consensus       141 VKtYSSGMkaRLgFAIA~~---------~dPDILIIDEaLSVGD~~F~~Kc~~rm~ef~e~gkTIvfVSHsl~~Vk~~C~  211 (549)
T PRK13545        141 VKTYSSGMKSRLGFAISVH---------INPDILVIDEALSVGDQTFTKKCLDKMNEFKEQGKTIFFISHSLSQVKSFCT  211 (549)
T ss_pred             HHHHCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCC
T ss_conf             6340886899999999982---------4999999946200578999999999999999789889999588899998573


Q ss_pred             CEEEEEECCCEEEE
Q ss_conf             60079972896895
Q gi|254780766|r  361 TAKFMRISNHQALC  374 (375)
Q Consensus       361 ~~~~~~i~~g~~~~  374 (375)
T Consensus       212 R--~iWLe~G~vr~  223 (549)
T PRK13545        212 K--ALWLHYGQVKE  223 (549)
T ss_pred             E--EEEEECCEEEE
T ss_conf             1--06343866787