HHsearch alignment for GI: 254780766 and conserved domain: PRK13635

>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=97.16  E-value=0.00035  Score=46.46  Aligned_cols=31  Identities=19%  Similarity=0.381  Sum_probs=25.4

Q ss_pred             HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH
Q ss_conf             45536732798-79998689986444899999
Q gi|254780766|r   18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS   48 (375)
Q Consensus        18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~   48 (375)
T Consensus        23 L~~isl~i~~GE~vaivG~nGsGKSTL~k~l~   54 (279)
T PRK13635         23 LKDVSFSVYEGEWVAIVGHNGSGKSTLAKLLN   54 (279)
T ss_pred             EEEEEEEECCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             76307688799899999999965999999997