HHsearch alignment for GI: 254780766 and conserved domain: PRK13636

>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=98.80  E-value=3.7e-08  Score=72.47  Aligned_cols=79  Identities=19%  Similarity=0.272  Sum_probs=67.0

Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC
Q ss_conf             312205899999999999999999870899789980122015989999999997417----9809998069678543212
Q gi|254780766|r  285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE  360 (375)
Q Consensus       285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~  360 (375)
T Consensus       140 ~~LSGGqkqRvaIA~aLa---------~~P~iLlLDEPTagLDp~~~~~i~~ll~~l~~e~g~TiilvtHd~~~v~~~aD  210 (285)
T PRK13636        140 HCLSFGQKKRVAIAGVLV---------MEPKVLVLDEPTAGLDPMGVSEIMKLLVEMQKELGLTIIIATHDIDIVPLYCD  210 (285)
T ss_pred             CCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC
T ss_conf             019999999999999997---------49989999787555999999999999999998449899999488999999699


Q ss_pred             CEEEEEECCCEEEE
Q ss_conf             60079972896895
Q gi|254780766|r  361 TAKFMRISNHQALC  374 (375)
Q Consensus       361 ~~~~~~i~~g~~~~  374 (375)
T Consensus       211 r--vivl~~G~iv~  222 (285)
T PRK13636        211 N--VFVMKEGRVIL  222 (285)
T ss_pred             E--EEEEECCEEEE
T ss_conf             9--99998998999