HHsearch alignment for GI: 254780766 and conserved domain: PRK13639

>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=97.31  E-value=0.00021  Score=47.99  Aligned_cols=34  Identities=15%  Similarity=0.263  Sum_probs=27.4

Q ss_pred             CCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHH
Q ss_conf             2545536732798-799986899864448999999
Q gi|254780766|r   16 RNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISF   49 (375)
Q Consensus        16 R~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~   49 (375)
T Consensus        16 ~al~~vsl~I~~Ge~vaiiG~nGsGKSTLl~~l~G   50 (275)
T PRK13639         16 VALKGINFKAEEGEMIAILGPNGAGKSTLFLHFNG   50 (275)
T ss_pred             EEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHC
T ss_conf             99986488998998999999999649999999973