HHsearch alignment for GI: 254780766 and conserved domain: PRK13642

>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=98.54  E-value=5.9e-07  Score=64.61  Aligned_cols=78  Identities=22%  Similarity=0.302  Sum_probs=63.3

Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC
Q ss_conf             312205899999999999999999870899789980122015989999999997417----9809998069678543212
Q gi|254780766|r  285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE  360 (375)
Q Consensus       285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~  360 (375)
T Consensus       139 ~~LSGGqrQRvaIA~aLa---------~~P~ililDEPTs~LD~~~~~~i~~ll~~L~~~~~~Tii~iTHdl~~~~~-a-  207 (277)
T PRK13642        139 ARLSGGQKQRVAVAGIIA---------LRPEIIILDESTSMLDPTGRSEIMRVIHEIKDKYHLTVLSITHDLDEAAS-S-  207 (277)
T ss_pred             HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHH-C-
T ss_conf             228999999999999996---------69999999588765898999999999999998169899999458899971-9-


Q ss_pred             CEEEEEECCCEEEE
Q ss_conf             60079972896895
Q gi|254780766|r  361 TAKFMRISNHQALC  374 (375)
Q Consensus       361 ~~~~~~i~~g~~~~  374 (375)
T Consensus       208 -Drv~vm~~G~Iv~  220 (277)
T PRK13642        208 -DRILVMRAGEIIK  220 (277)
T ss_pred             -CEEEEEECCEEEE
T ss_conf             -9899998999999