HHsearch alignment for GI: 254780766 and conserved domain: PRK13652

>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=98.74  E-value=9.6e-08  Score=69.75  Aligned_cols=79  Identities=23%  Similarity=0.329  Sum_probs=67.7

Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC
Q ss_conf             312205899999999999999999870899789980122015989999999997417----9809998069678543212
Q gi|254780766|r  285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE  360 (375)
Q Consensus       285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~  360 (375)
T Consensus       136 ~~LSGGqkqRvaiA~aL~---------~~P~lLlLDEPtagLDp~~~~~i~~~l~~l~~~~g~Tii~vtHdl~~v~~~aD  206 (277)
T PRK13652        136 HHLSGGEKKRVAIAGILA---------MEPQVLVLDEPTAGLDPQGVKELFDFLNALPETYGMTVIFSTHQVELVAEMAD  206 (277)
T ss_pred             HHCCHHHHHHHHHHHHHH---------HCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC
T ss_conf             448999999999999998---------29999998397454899999999999999998509899999148999999799


Q ss_pred             CEEEEEECCCEEEE
Q ss_conf             60079972896895
Q gi|254780766|r  361 TAKFMRISNHQALC  374 (375)
Q Consensus       361 ~~~~~~i~~g~~~~  374 (375)
T Consensus       207 r--i~vl~~G~ii~  218 (277)
T PRK13652        207 Y--IYVMEKGEIVG  218 (277)
T ss_pred             E--EEEEECCEEEE
T ss_conf             9--99998999999