HHsearch alignment for GI: 254780766 and conserved domain: TIGR03608

>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=96.72  E-value=0.0017  Score=42.06  Aligned_cols=33  Identities=30%  Similarity=0.612  Sum_probs=26.1

Q ss_pred             HHHEEEECCC-CEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             4553673279-87999868998644489999997
Q gi|254780766|r   18 YASLRLVFDA-QHTIFVGDNGVGKTNILEAISFL   50 (375)
Q Consensus        18 ~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~~l   50 (375)
T Consensus        14 L~~vsl~i~~Ge~~~i~GpSGsGKSTLL~~i~gl   47 (206)
T TIGR03608        14 LDDLNLTIEKGKMVAIVGESGSGKSTLLNIIGLL   47 (206)
T ss_pred             ECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCC
T ss_conf             7580779869989999879997099999999759