>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=99.51 E-value=4.9e-13 Score=104.29 Aligned_cols=74 Identities=20% Similarity=0.337 Sum_probs=61.8 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCEE Q ss_conf 2205899999999999999999870899789980122015989999999997417---9809998069678543212600 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) T Consensus 81 LSgGqkqrv~iA~al~---------~~p~ililDEPtsgLD~~~~~~l~~~i~~l~~~g~tii~vtH~~~~~~~~~d~-- 149 (157) T cd00267 81 LSGGQRQRVALARALL---------LNPDLLLLDEPTSGLDPASRERLLELLRELAEEGRTVIIVTHDPELAELAADR-- 149 (157) T ss_pred CCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE-- T ss_conf 8869999999999997---------09999999698766899999999999999996899999990899999997999-- Q ss_pred EEEECCCE Q ss_conf 79972896 Q gi|254780766|r 364 FMRISNHQ 371 (375) Q Consensus 364 ~~~i~~g~ 371 (375) T Consensus 150 v~~~~~Gk 157 (157) T cd00267 150 VIVLKDGK 157 (157) T ss_pred EEEEECCC T ss_conf 99974888

HHsearch alignment for GI: 254780766 and conserved domain: cd00267