HHsearch alignment for GI: 254780766 and conserved domain: cd03219

>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).
Probab=98.55  E-value=8.3e-07  Score=63.64  Aligned_cols=80  Identities=23%  Similarity=0.341  Sum_probs=66.7

Q ss_pred             HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHC
Q ss_conf             3312205899999999999999999870899789980122015989999999997417---9809998069678543212
Q gi|254780766|r  284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNE  360 (375)
Q Consensus       284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~  360 (375)
T Consensus       141 ~~~LSGG~~Qrv~iAral~---------~~P~lliLDEPT~gLD~~~~~~i~~~l~~l~~~G~tii~vsHdl~~~~~~~D  211 (236)
T cd03219         141 AGELSYGQQRRLEIARALA---------TDPKLLLLDEPAAGLNPEETEELAELIRELRERGITVLLVEHDMDVVMSLAD  211 (236)
T ss_pred             HHHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC
T ss_conf             2669999999999999996---------5999999948765899999999999999999659999999174899999699


Q ss_pred             CEEEEEECCCEEEE
Q ss_conf             60079972896895
Q gi|254780766|r  361 TAKFMRISNHQALC  374 (375)
Q Consensus       361 ~~~~~~i~~g~~~~  374 (375)
T Consensus       212 r--v~vm~~G~iv~  223 (236)
T cd03219         212 R--VTVLDQGRVIA  223 (236)
T ss_pred             E--EEEEECCEEEE
T ss_conf             9--99998999999