HHsearch alignment for GI: 254780766 and conserved domain: cd03220

>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.
Probab=98.75  E-value=8.8e-08  Score=69.98  Aligned_cols=79  Identities=20%  Similarity=0.213  Sum_probs=66.8

Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC
Q ss_conf             312205899999999999999999870899789980122015989999999997417---98099980696785432126
Q gi|254780766|r  285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET  361 (375)
Q Consensus       285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~  361 (375)
T Consensus       141 ~~LSgG~kqRl~iA~al~---------~~P~illLDEPt~gLD~~~~~~i~~~i~~l~~~g~tiii~sH~l~~v~~lcdr  211 (224)
T cd03220         141 KTYSSGMKARLAFAIATA---------LEPDILLIDEVLAVGDAAFQEKCQRRLRELLKQGKTVILVSHDPSSIKRLCDR  211 (224)
T ss_pred             CCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE
T ss_conf             546999999999999996---------69999999188665699999999999999985899999988988999996999


Q ss_pred             EEEEEECCCEEEE
Q ss_conf             0079972896895
Q gi|254780766|r  362 AKFMRISNHQALC  374 (375)
Q Consensus       362 ~~~~~i~~g~~~~  374 (375)
T Consensus       212 --iivl~~G~Iv~  222 (224)
T cd03220         212 --ALVLEKGKIRF  222 (224)
T ss_pred             --EEEEECCEEEE
T ss_conf             --99998999998