HHsearch alignment for GI: 254780766 and conserved domain: cd03221

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth. EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site. The reaction requires ATP hydrolysis. EF-3 contains two ATP nucleotide binding sequence (NBS) motifs. NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=99.42  E-value=7.7e-12  Score=96.48  Aligned_cols=74  Identities=22%  Similarity=0.344  Sum_probs=64.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHCCEEEEE
Q ss_conf             22058999999999999999998708997899801220159899999999974179809998069678543212600799
Q gi|254780766|r  287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMR  366 (375)
Q Consensus       287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Qv~iTt~~~~~~~~~~~~~~~~~  366 (375)
T Consensus        71 LSgGqkqr~~la~al~---------~~p~iliLDEPt~~LD~~~~~~i~~~l~~~~~tii~vsHd~~~~~~~~dr--ii~  139 (144)
T cd03221          71 LSGGEKMRLALAKLLL---------ENPNLLLLDEPTNHLDLESIEALEEALKEYPGTVILVSHDRYFLDQVATK--IIE  139 (144)
T ss_pred             CCHHHHHHHHHHHHHC---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE--EEE
T ss_conf             7999999999999972---------59989999577555899999999999997099999996798999987999--999


Q ss_pred             ECCCE
Q ss_conf             72896
Q gi|254780766|r  367 ISNHQ  371 (375)
Q Consensus       367 i~~g~  371 (375)
T Consensus       140 l~~G~  144 (144)
T cd03221         140 LEDGK  144 (144)
T ss_pred             EECCC
T ss_conf             92989