HHsearch alignment for GI: 254780766 and conserved domain: cd03223

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome. The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation. To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes. X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family. The disease is characterized by a striking and unpredictable variation in phenotypic expression. Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt
Probab=97.26  E-value=0.00026  Score=47.29  Aligned_cols=31  Identities=19%  Similarity=0.485  Sum_probs=25.6

Q ss_pred             HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH
Q ss_conf             45536732798-79998689986444899999
Q gi|254780766|r   18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS   48 (375)
Q Consensus        18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~   48 (375)
T Consensus        17 l~~isl~i~~Ge~v~i~G~sGsGKSTLl~~l~   48 (166)
T cd03223          17 LKDLSFEIKPGDRLLITGPSGTGKSSLFRALA   48 (166)
T ss_pred             EEEEEEEECCCCEEEEECCCCCCHHHHHHHHC
T ss_conf             94458898899999999589998899999986