HHsearch alignment for GI: 254780766 and conserved domain: cd03231

>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter. The CCM family is involved in bacterial cytochrome c biogenesis. Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH). CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH. The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.
Probab=97.37  E-value=0.00016  Score=48.67  Aligned_cols=31  Identities=29%  Similarity=0.567  Sum_probs=25.5

Q ss_pred             HHHEEEECCC-CEEEEECCCCCCHHHHHHHHH
Q ss_conf             4553673279-879998689986444899999
Q gi|254780766|r   18 YASLRLVFDA-QHTIFVGDNGVGKTNILEAIS   48 (375)
Q Consensus        18 ~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~   48 (375)
T Consensus        16 l~~vs~~i~~Ge~~~l~G~NGsGKSTLlk~i~   47 (201)
T cd03231          16 FSGLSFTLAAGEALQVTGPNGSGKTTLLRILA   47 (201)
T ss_pred             EECCEEEECCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             95307888799599999999999999999996