HHsearch alignment for GI: 254780766 and conserved domain: cd03242

>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage. When replication is prematurely disrupted by DNA damage, several recF pathway gene products play critical roles processing the arrested replication fork, allowing it to resume and complete its task. This CD represents the nucleotide binding domain of RecF. RecF belongs to a large superfamily of ABC transporters involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases with a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=100.00  E-value=0  Score=514.72  Aligned_cols=269  Identities=33%  Similarity=0.549  Sum_probs=245.9

Q ss_pred             EEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCEEEEEEEECCCCCCE
Q ss_conf             99999922325455367327987999868998644489999997288666678736887489832058988862853200
Q gi|254780766|r    7 IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGMEGLA   86 (375)
Q Consensus         7 i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gksfR~~~~~~li~~~~~~~~~~~~~~~~~~~~~   86 (375)
T Consensus         1 i~~L~l~nFRn~~~~~l~~~~~~n~i~G~NGsGKTnlLEAI~~ls~grSFR~~~~~~lI~~~~~~~-~v~~~~~~~~~~~   79 (270)
T cd03242           1 LKSLELRNFRNYAELELEFEPGVTVLVGENAQGKTNLLEAISLLATGKSHRTSRDKELIRWGAEEA-KISAVLERQGGEL   79 (270)
T ss_pred             CCEEEEECCCCCCCCEEECCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHCCCCCCE-EEEEEEEECCCEE
T ss_conf             967876476698505672499948999999887899999999981799888675588852789858-9999999899607


Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCHHHCCCCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             26675300246633321125774333210123334520210011001268723412101000135846778887777666
Q gi|254780766|r   87 DISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLM  166 (375)
Q Consensus        87 ~~~~~~~~~~~~~~k~~~~n~~~~~~~~~l~~~l~~v~~~p~~~~li~~~p~~RR~flD~~i~~~~~~y~~~l~~y~K~L  166 (375)
T Consensus        80 ~~~~~~~--~~-~~k~~~in~~~~~~~s~l~~~lp~v~~~P~~~~li~g~p~~RR~flD~~i~~~~~~y~~~l~~Y~k~L  156 (270)
T cd03242          80 ALELTIR--SG-GGRKARLNGIKVRRLSDLLGVLNAVWFAPEDLELVKGSPADRRRFLDRLLGQLEPAYAHVLSEYQKAL  156 (270)
T ss_pred             EEEEEEE--CC-CCEEEEECCCCCCCHHHHHHHCCEEEEECCHHHHHHCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHH
T ss_conf             9999994--39-95499999903504898871088899923755466179488999999999862999999999999999


Q ss_pred             HHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHH
Q ss_conf             66798863056543210024565327999999999999999999999998531643011220156667655896788887
Q gi|254780766|r  167 RGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEE  246 (375)
Q Consensus       167 kqRN~lLk~~~~d~~~l~~~~~qla~~~~~I~~~R~~~l~~l~~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~e~  246 (375)
T Consensus       157 kQRN~lLK------------------------------------------------------------------------  164 (270)
T cd03242         157 RQRNALLK------------------------------------------------------------------------  164 (270)
T ss_pred             HHHHHHHC------------------------------------------------------------------------
T ss_conf             99999837------------------------------------------------------------------------


Q ss_pred             HHHHHHHCCCHHHCCEEECCCCCCEEEECCCCCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCC
Q ss_conf             65455311100000000025732001100124551023312205899999999999999999870899789980122015
Q gi|254780766|r  247 YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHL  326 (375)
Q Consensus       247 ~~~~L~~~~~~d~~~~~t~~Gphr~d~~~~~~~~~~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~L  326 (375)
T Consensus       165 --------------------GpHrdD~~~~~~~~~~-~~~~S~GQqK~~~~~l~Laq~~~~~~~~~~~PilLlDDi~seL  223 (270)
T cd03242         165 --------------------GPHRDDLLFFLNDKPA-ADFGSQGQQRTLALALKLAEIQLIKEVSGEYPVLLLDDVLAEL  223 (270)
T ss_pred             --------------------CCCHHHEEEEECCEEH-HHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCHHHHH
T ss_conf             --------------------9981217998798707-8767878999999999999999999986999789972315540


Q ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCHHHHHHH-HCCEEEEEECCCEEE
Q ss_conf             98999999999741798099980696785432-126007997289689
Q gi|254780766|r  327 DEDKRNALFRIVTDIGSQIFMTGTDKSVFDSL-NETAKFMRISNHQAL  373 (375)
Q Consensus       327 D~~~~~~ll~~l~~~~~Qv~iTt~~~~~~~~~-~~~~~~~~i~~g~~~  373 (375)
T Consensus       224 D~~r~~~l~~~l~~~~-QvfiT~t~~~~~~~~~~~~~~~F~Ve~G~it  270 (270)
T cd03242         224 DLGRQAALLDAIEGRV-QTFVTTTDLADFDALWLRRAQIFRVDAGTLS  270 (270)
T ss_pred             CHHHHHHHHHHHCCCC-CEEEECCCHHHHHHHCCCCCCEEEECCCEEC
T ss_conf             9999999999870189-7999757857745433466738998087979