HHsearch alignment for GI: 254780766 and conserved domain: cd03245

>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2. A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.
Probab=98.53  E-value=1.5e-06  Score=62.02  Aligned_cols=77  Identities=19%  Similarity=0.308  Sum_probs=61.8

Q ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEE
Q ss_conf             12205899999999999999999870899789980122015989999999997417--9809998069678543212600
Q gi|254780766|r  286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAK  363 (375)
Q Consensus       286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~  363 (375)
T Consensus       140 ~LSgGqkQri~lARal~---------~~~~ililDEpts~LD~~~~~~i~~~l~~~~~~~Tvi~itH~~~~~~~---~D~  207 (220)
T cd03245         140 GLSGGQRQAVALARALL---------NDPPILLLDEPTSAMDMNSEERLKERLRQLLGDKTLIIITHRPSLLDL---VDR  207 (220)
T ss_pred             EECHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHH---CCE
T ss_conf             21899999999999995---------599999996875688989999999999987699989999359889984---999


Q ss_pred             EEEECCCEEEE
Q ss_conf             79972896895
Q gi|254780766|r  364 FMRISNHQALC  374 (375)
Q Consensus       364 ~~~i~~g~~~~  374 (375)
T Consensus       208 Iivl~~G~Iv~  218 (220)
T cd03245         208 IIVMDSGRIVA  218 (220)
T ss_pred             EEEEECCEEEE
T ss_conf             99998999998