HHsearch alignment for GI: 254780766 and conserved domain: cd03245

>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2. A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.
Probab=96.88  E-value=0.001  Score=43.53  Aligned_cols=31  Identities=23%  Similarity=0.507  Sum_probs=25.6

Q ss_pred             HHHEEEECCC-CEEEEECCCCCCHHHHHHHHH
Q ss_conf             4553673279-879998689986444899999
Q gi|254780766|r   18 YASLRLVFDA-QHTIFVGDNGVGKTNILEAIS   48 (375)
Q Consensus        18 ~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~   48 (375)
T Consensus        20 L~~isl~i~~G~~v~ivG~sGsGKSTLl~ll~   51 (220)
T cd03245          20 LDNVSLTIRAGEKVAIIGRVGSGKSTLLKLLA   51 (220)
T ss_pred             EECEEEEECCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             53459998799999999999985999999996