>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain. They export degradative enzymes by using a type I protein secretion system and lack an N-terminal signal peptide, but contain a C-terminal secretion signal. The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP). For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli. The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior. HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels. The spectrum of transport substra

Probab=99.32 E-value=3.9e-11 Score=91.90 Aligned_cols=74 Identities=22% Similarity=0.332 Sum_probs=58.5 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCEE Q ss_conf 2205899999999999999999870899789980122015989999999997417---9809998069678543212600 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) T Consensus 97 LSGGQkQRvalARal~---------~~p~ililDEpts~LD~~~e~~i~~~l~~l~~~~~Tvi~vtH~~~~~~~---aD~ 164 (173) T cd03246 97 LSGGQRQRLGLARALY---------GNPRILVLDEPNSHLDVEGERALNQAIAALKAAGATRIVIAHRPETLAS---ADR 164 (173) T ss_pred CCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHH---CCE T ss_conf 7699999999999982---------7999999968766899899999999999786489899998479999984---999 Q ss_pred EEEECCCEE Q ss_conf 799728968 Q gi|254780766|r 364 FMRISNHQA 372 (375) Q Consensus 364 ~~~i~~g~~ 372 (375) T Consensus 165 Iivl~~GkI 173 (173) T cd03246 165 ILVLEDGRV 173 (173) T ss_pred EEEEECCCC T ss_conf 999939999

HHsearch alignment for GI: 254780766 and conserved domain: cd03246