HHsearch alignment for GI: 254780766 and conserved domain: cd03253

>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria. Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=96.82  E-value=0.0011  Score=43.31  Aligned_cols=31  Identities=26%  Similarity=0.442  Sum_probs=24.3

Q ss_pred             HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH
Q ss_conf             45536732798-79998689986444899999
Q gi|254780766|r   18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS   48 (375)
Q Consensus        18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~   48 (375)
T Consensus        17 L~~isl~i~~Ge~v~ivG~sGsGKSTLl~ll~   48 (236)
T cd03253          17 LKDVSFTIPAGKKVAIVGPSGSGKSTILRLLF   48 (236)
T ss_pred             EECEEEEECCCCEEEEECCCCCCHHHHHHHHC
T ss_conf             30568998699999999999998999999974