>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein. In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=98.48 E-value=1.6e-06 Score=61.85 Aligned_cols=77 Identities=16% Similarity=0.314 Sum_probs=61.4 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEE Q ss_conf 12205899999999999999999870899789980122015989999999997417--9809998069678543212600 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) T Consensus 139 ~LSgGq~Qri~lARal~---------~~~~illlDEpts~LD~~t~~~i~~~l~~~~~~~TvI~itH~~~~~~~-~D--~ 206 (229) T cd03254 139 NLSQGERQLLAIARAML---------RDPKILILDEATSNIDTETEKLIQEALEKLMKGRTSIIIAHRLSTIKN-AD--K 206 (229) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHH-CC--E T ss_conf 49999999999999995---------189989998977789989999999999998099889999269889985-99--9 Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) T Consensus 207 iivl~~G~Iv~ 217 (229) T cd03254 207 ILVLDDGKIIE 217 (229) T ss_pred EEEEECCEEEE T ss_conf 99998999999

HHsearch alignment for GI: 254780766 and conserved domain: cd03254