>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient. The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).

Probab=98.61 E-value=3.9e-07 Score=65.75 Aligned_cols=78 Identities=18% Similarity=0.185 Sum_probs=64.9 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCC--CCEEEEECCHHHHHHHHCCEE Q ss_conf 122058999999999999999998708997899801220159899999999974179--809998069678543212600 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIG--SQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~--~Qv~iTt~~~~~~~~~~~~~~ 363 (375) T Consensus 141 ~LSGGq~QRvaIArAL~---------~~P~iLllDEPTs~LD~~~~~~i~~li~~l~~~~Tii~vTHdl~~a~~~aDr-- 209 (227) T cd03260 141 GLSGGQQQRLCLARALA---------NEPEVLLLDEPTSALDPISTAKIEELIAELKKEYTIVIVTHNMQQAARVADR-- 209 (227) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHCCE-- T ss_conf 28999999999999983---------5999999689876579899999999999996688899993699999986999-- Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) T Consensus 210 i~vl~~G~ive 220 (227) T cd03260 210 TAFLLNGRLVE 220 (227) T ss_pred EEEEECCEEEE T ss_conf 99998989999

HHsearch alignment for GI: 254780766 and conserved domain: cd03260