>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component. The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=99.47 E-value=1.2e-11 Score=95.30 Aligned_cols=80 Identities=20% Similarity=0.271 Sum_probs=67.3 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCC Q ss_conf 3312205899999999999999999870899789980122015989999999997417--98099980696785432126 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~ 361 (375) T Consensus 128 ~~~LSgG~kqrv~ia~al~---------~~P~lliLDEPt~gLDp~~~~~~~~ll~~l~~~~tii~stH~l~e~e~~~dr 198 (211) T cd03264 128 IGSLSGGMRRRVGIAQALV---------GDPSILIVDEPTAGLDPEERIRFRNLLSELGEDRIVILSTHIVEDVESLCNQ 198 (211) T ss_pred HHHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHCCE T ss_conf 4458988999999999982---------8999999948976789999999999999972998999989988999996999 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) T Consensus 199 --i~il~~G~iv~ 209 (211) T cd03264 199 --VAVLNKGKLVF 209 (211) T ss_pred --EEEEECCEEEE T ss_conf --99998999998

HHsearch alignment for GI: 254780766 and conserved domain: cd03264