HHsearch alignment for GI: 254780766 and conserved domain: cd03272

>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=99.92  E-value=4.2e-24  Score=176.54  Aligned_cols=219  Identities=21%  Similarity=0.345  Sum_probs=131.3

Q ss_pred             EEEEEEECCCCH-HHEEEE-CCCCEEEEECCCCCCHHHHHHHHHHHCC--CCCCCCCCHHHHHHCCCCCEEEEEEEE---
Q ss_conf             999999223254-553673-2798799986899864448999999728--866667873688748983205898886---
Q gi|254780766|r    7 IKFLNISEFRNY-ASLRLV-FDAQHTIFVGDNGVGKTNILEAISFLSP--GRGFRRASYADVTRIGSPSFFSTFARV---   79 (375)
Q Consensus         7 i~~l~i~nFR~~-~~~~i~-f~~~~n~i~G~NG~GKT~iLEAI~~l~~--gksfR~~~~~~li~~~~~~~~~~~~~~---   79 (375)
T Consensus         1 iK~i~i~GFKSf~d~t~i~~f~p~~taIVGpNGsGKSNi~dAIrwVLGe~~~~lR~~~~~dvIf~Gs~~~-~~~A~Vei~   79 (243)
T cd03272           1 IKQVIIQGFKSYKDQTVIEPFSPKHNVVVGRNGSGKSNFFAAIRFVLSDEYTHLREEQRQALLHEGSGPS-VMSAYVEII   79 (243)
T ss_pred             CCEEEEECEECCCCCEEECCCCCCCCEEECCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHEECCCCCC-CCEEEEEEE
T ss_conf             9479992700577765731479996379899876604367761256537755542455676442578988-620699999


Q ss_pred             -CCCCC-----CEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCHHHCCCCCCHHHHHHCCCCCCCCCH
Q ss_conf             -28532-----002667530024663332112577433321012333452021001100126872341210100013584
Q gi|254780766|r   80 -EGMEG-----LADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDP  153 (375)
Q Consensus        80 -~~~~~-----~~~~~~~~~~~~~~~~k~~~~n~~~~~~~~~l~~~l~~v~~~p~~~~li~~~p~~RR~flD~~i~~~~~  153 (375)
T Consensus        80 fDNsd~~~~~~~~Ei~irR~i~~~~--seY~iN~~~~rl-kDI~~lf~~tGlg~~-----------------------np  133 (243)
T cd03272          80 FDNSDNRFPIDKEEVRLRRTIGLKK--DEYFLDKKNVTK-NDVMNLLESAGFSRS-----------------------NP  133 (243)
T ss_pred             EECCCCCCCCCCCEEEEEEEEECCC--CEEEECCCCCCH-HHHHHHHHHCCCCCC-----------------------CC
T ss_conf             9788887689986799999995798--579899870369-999998753599989-----------------------98


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCC
Q ss_conf             67788877776666679886305654321002456532799999999999999999999999853164301122015666
Q gi|254780766|r  154 RHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLD  233 (375)
Q Consensus       154 ~y~~~l~~y~K~LkqRN~lLk~~~~d~~~l~~~~~qla~~~~~I~~~R~~~l~~l~~~l~~~~~~~~~~~~~~~l~~~~~  233 (375)
T Consensus       134 y----------------~II~QG~I------------------------------------------------------~  143 (243)
T cd03272         134 Y----------------YIVPQGKI------------------------------------------------------N  143 (243)
T ss_pred             C----------------EEEECCCC------------------------------------------------------C
T ss_conf             7----------------79966735------------------------------------------------------3


Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCHHHCCEEECCCCCCEEEECCCCCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             76558967888876545531110000000002573200110012455102331220589999999999999999987089
Q gi|254780766|r  234 GKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGF  313 (375)
Q Consensus       234 ~~~~~~~~~~~e~~~~~L~~~~~~d~~~~~t~~Gphr~d~~~~~~~~~~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~  313 (375)
T Consensus       144 ~i~n~kP----eE~----------------------------------r~i~~~~~~~k~~~alalifai-----~~~~P  180 (243)
T cd03272         144 SLTNMKQ----DEQ----------------------------------QEMQQLSGGQKSLVALALIFAI-----QKCDP  180 (243)
T ss_pred             HHHCCCH----HHH----------------------------------HHHHHHCCCHHHHHHHHHHHHH-----HCCCC
T ss_conf             3032991----999----------------------------------9999971346779999999998-----45599


Q ss_pred             CCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEEEEEEC
Q ss_conf             9789980122015989999999997417--980999806967854321260079972
Q gi|254780766|r  314 APILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAKFMRIS  368 (375)
Q Consensus       314 ~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~~~~i~  368 (375)
T Consensus       181 aPfyllDEidaaLD~~~~~~v~~~ik~ls~~~QfI~ithr~~~~~~Ad-~--~ygV~  234 (243)
T cd03272         181 APFYLFDEIDAALDAQYRTAVANMIKELSDGAQFITTTFRPELLEVAD-K--FYGVK  234 (243)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH-H--EEEEE
T ss_conf             837887134401599899999999999734984999980889997506-4--37269